PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P25820_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 789aa    MW: 86519.2 Da    PI: 5.9545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P25820_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.8e-2099155157
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                             +++ +++t++q++e+e++F+++++p+ ++r eL+++lgL+  qVk+WFqN+R+++k+
  GSMUA_Achr11P25820_001  99 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRNELSRQLGLEPLQVKFWFQNKRTQMKN 155
                             678899************************************************995 PP

2START224.33.8e-702654851206
                             HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                   START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                             ela +a++el+++a+++ep+W        e +n+de++++f+++ +      ++ea+r+++vv+m+++ +ve+l+d++ qW + +  
  GSMUA_Achr11P25820_001 265 ELAVAAMEELIRMAQLSEPLWIPGLdgaaETLNEDEYVRTFPRGIGpkllgLKSEASRETAVVIMNQMHVVEILMDVN-QWANVFSg 350
                             57899*****************999999***************999********************************.******** PP

                             ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEE CS
                   START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgili 154
                                +a tlev+s+g      galq+m+ae+q++splvp R+++fvRy++q+ +g+w++vdvS+ds ++ p    v R++++pSg+li
  GSMUA_Achr11P25820_001 351 ivsRALTLEVLSTGvagnynGALQVMSAEFQVPSPLVPtRESLFVRYCKQHADGTWAVVDVSLDSLRPSP----VLRCRRRPSGCLI 433
                             ********************************************************************98....7************ PP

                             EEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                   START 155 epksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                             ++++ng+skvtwvehv++++r++h+++r+lv+sgla+gak+wv+tl+rqce+
  GSMUA_Achr11P25820_001 434 QEMPNGYSKVTWVEHVEVDDRSVHNIYRPLVNSGLAFGAKRWVSTLDRQCER 485
                             **************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2278154IPR009057Homeodomain-like
SuperFamilySSF466891.46E-1987156IPR009057Homeodomain-like
PROSITE profilePS5007117.02296156IPR001356Homeobox domain
SMARTSM003897.5E-2097160IPR001356Homeobox domain
CDDcd000861.87E-1998157No hitNo description
PfamPF000469.6E-1899154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084844.084256488IPR002913START domain
SuperFamilySSF559615.5E-36259487No hitNo description
CDDcd088751.74E-127260484No hitNo description
SMARTSM002344.6E-68265485IPR002913START domain
PfamPF018524.3E-59266485IPR002913START domain
Gene3DG3DSA:3.30.530.201.9E-6361484IPR023393START-like domain
SuperFamilySSF559612.2E-23504714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MPVGLMIPAR QPPSMIGRNT GTGYGSSSVL SLSQPNLLEG QQIPLQHQHH NQFVEIAQAT  60
TAESEMARAR EDDFESKSCS ENIEGASGDD QDQNQRPRKK RYHRHTQHQI QEMEAFFKEC  120
PHPDDKQRNE LSRQLGLEPL QVKFWFQNKR TQMKNQHERQ ENSQLRADNE KLRADNLRYK  180
EALSNASCPN CGGPAALGEM SFDEHNLRIE NVRLREEIDR ISGIAAKYVG KPVASYPLLS  240
PAIPSRSPLD LGVGGLGIEK PVVIELAVAA MEELIRMAQL SEPLWIPGLD GAAETLNEDE  300
YVRTFPRGIG PKLLGLKSEA SRETAVVIMN QMHVVEILMD VNQWANVFSG IVSRALTLEV  360
LSTGVAGNYN GALQVMSAEF QVPSPLVPTR ESLFVRYCKQ HADGTWAVVD VSLDSLRPSP  420
VLRCRRRPSG CLIQEMPNGY SKVTWVEHVE VDDRSVHNIY RPLVNSGLAF GAKRWVSTLD  480
RQCERLASVM ASNIPSGDIG VITTPEGRKS MLKLAERMVI SFCGGVGGSA SHQWTTLSGS  540
GAEDVRVMTR KSVDDPGRPP GIVLNAATSF WLPVPPKRVF DFLRDESSRS EWDILSNGGG  600
VQEMAHIANG RDHGNCVSLL RVNSTNSSQS NMLILQESCT DSTGSYVIYA PVDVIAMNVV  660
LNGGDPDYVA LLPSGFAILP DGPCGGQGGE MVDGVGSGGS LLTVAFQILV DSAPTAKLSL  720
GSCPLSLKNT QDMQERVEFG ASIVGSQERT SDLPCSVVLV WRPGSNNPIY SLISHHFILC  780
FVLFLWCWL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385059.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLM0RVG20.0M0RVG2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P25820_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2